Lineage for d2b9ni1 (2b9n I:56-149)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730576Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 730577Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
  5. 730578Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 730579Protein Ribosomal protein L9 C-domain [55655] (2 species)
  7. 730580Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries)
  8. 730584Domain d2b9ni1: 2b9n I:56-149 [128151]
    Other proteins in same PDB: d2b9n21, d2b9n31, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nw1, d2b9nx1, d2b9ny1
    automatically matched to d1div_1

Details for d2b9ni1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L9

SCOP Domain Sequences for d2b9ni1:

Sequence, based on SEQRES records: (download)

>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records): (download)

>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

SCOP Domain Coordinates for d2b9ni1:

Click to download the PDB-style file with coordinates for d2b9ni1.
(The format of our PDB-style files is described here.)

Timeline for d2b9ni1: