![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) ![]() |
![]() | Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
![]() | Protein Ribosomal protein L9 C-domain [55655] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries) |
![]() | Domain d2b9ni1: 2b9n I:56-149 [128151] Other proteins in same PDB: d2b9n21, d2b9n31, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nw1, d2b9nx1, d2b9ny1 automatically matched to d1div_1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOP Domain Sequences for d2b9ni1:
Sequence, based on SEQRES records: (download)
>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki eladairalgytnvpvklhpevtatlkvhvteqk
>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie ladairalgytnvpvklhpevtatlkvhvteqk
Timeline for d2b9ni1: