Lineage for d2b7ca3 (2b7c A:5-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124522Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 2124523Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries)
  8. 2124525Domain d2b7ca3: 2b7c A:5-240 [128032]
    Other proteins in same PDB: d2b7ca1, d2b7ca2, d2b7cb_
    automated match to d1f60a3
    mutant

Details for d2b7ca3

PDB Entry: 2b7c (more details), 1.8 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d2b7ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ca3 c.37.1.8 (A:5-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldklk
aerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgefe
agiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynpk
tvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

SCOPe Domain Coordinates for d2b7ca3:

Click to download the PDB-style file with coordinates for d2b7ca3.
(The format of our PDB-style files is described here.)

Timeline for d2b7ca3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b7cb_