![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species) eukaryotic and archaeal homologue of EF-Tu |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries) |
![]() | Domain d2b7ca3: 2b7c A:5-240 [128032] Other proteins in same PDB: d2b7ca1, d2b7ca2, d2b7cb_ automated match to d1f60a3 mutant |
PDB Entry: 2b7c (more details), 1.8 Å
SCOPe Domain Sequences for d2b7ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ca3 c.37.1.8 (A:5-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldklk aerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgefe agiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynpk tvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
Timeline for d2b7ca3: