Lineage for d1f60a3 (1f60 A:2-240)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
eukaryotic and archaeal homologue of EF-TuSpecies Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (6 PDB entries) 
Domain d1f60a3: 1f60 A:2-240 [32140]
Other proteins in same PDB: d1f60a1, d1f60a2, d1f60b_
Details for d1f60a3
PDB Entry: 1f60 (more details), 1.67 Å
PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
PDB Compounds: (A:) elongation factor eef1aSCOPe Domain Sequences for d1f60a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
SCOPe Domain Coordinates for d1f60a3:
Click to download the PDB-style file with coordinates for d1f60a3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f60a3:
- d1f60a3 first appeared (with stable ids) in SCOP 1.55
- d1f60a3 appears in SCOPe 2.05
- d1f60a3 appears in SCOPe 2.07
- d1f60a3 appears in the current release, SCOPe 2.08
View in 3D
