SCOPe 2.08: Domain d2b78a1: 2b78 A:1-68

Lineage for d2b78a1 (2b78 A:1-68)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein SMu776, N-terminal domain [141719] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [141720] (2 PDB entries)
   Uniprot Q8DUW5 1-68

8. Domain d2b78a1: 2b78 A:1-68 [128025]
   Other proteins in same PDB: d2b78a2

Details for d2b78a1

PDB Entry: 2b78, 2 Å

PDB Description: a putative sam-dependent methyltransferase from streptococcus mutans

PDB Compounds: (A:) hypothetical protein SMU.776

SCOPe Domain Sequences for d2b78a1:

Sequence; same for both SEQRES and ATOM records:

>d2b78a1 b.122.1.9 (A:1-68) Hypothetical protein SMu776, N-terminal domain {Streptococcus mutans [TaxId: 1309]}
miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw
lispkkvs

Timeline for d2b78a1:

• d2b78a1 first appeared in SCOP 1.73
  
• d2b78a1 appears in SCOPe 2.07