Lineage for d2b78a1 (2b78 A:1-68)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432997Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 2433002Protein Hypothetical protein SMu776, N-terminal domain [141719] (1 species)
  7. 2433003Species Streptococcus mutans [TaxId:1309] [141720] (2 PDB entries)
    Uniprot Q8DUW5 1-68
  8. 2433004Domain d2b78a1: 2b78 A:1-68 [128025]
    Other proteins in same PDB: d2b78a2

Details for d2b78a1

PDB Entry: 2b78 (more details), 2 Å

PDB Description: a putative sam-dependent methyltransferase from streptococcus mutans
PDB Compounds: (A:) hypothetical protein SMU.776

SCOPe Domain Sequences for d2b78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b78a1 b.122.1.9 (A:1-68) Hypothetical protein SMu776, N-terminal domain {Streptococcus mutans [TaxId: 1309]}
miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw
lispkkvs

SCOPe Domain Coordinates for d2b78a1:

Click to download the PDB-style file with coordinates for d2b78a1.
(The format of our PDB-style files is described here.)

Timeline for d2b78a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b78a2