PDB entry 2b78

View 2b78 on RCSB PDB site
Description: A putative sam-dependent methyltransferase from Streptococcus mutans
Class: structural genomics, unknown function
Keywords: structure genomics, METHYLTRANSFERASE, caries, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-10-03, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SMU.776
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b78a1, d2b78a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b78A (A:)
    miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw
    lispkkvslnvtyfiklfqwskdkrknfahsklttayrlfnqdgdsfggvtidcygdfvl
    fswynsfvyqirdeivaafrqvypnflgayekirfkgidnvsahlygqeapeqflileng
    isynvflndglmtgifldqrqvrnelingsaagktvlnlfsytaafsvaaamggamatts
    vdlakrsralslahfeanhldmanhqlvvmdvfdyfkyarrhhltydiiiidppsfarnk
    kevfsvskdyhklirqgleilsengliiastnaanmtvsqfkkqiekgfgkqkhtyldlq
    qlpsdfavnvqdessnylkvftikv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b78A (A:)
    miklmvgsfaekklkrgvqllssrdypnlnldnqvvqlysdadiflgtaylskqnkgvgw
    lispkkvslnvtyfiklfqwskdkrknfahsklttayrlfnqdgdsfggvtidcygdfvl
    fswynsfvyqirdeivaafrqvypnflgayekirfnvsahlygqeapeqflilengisyn
    vflndglmtgifldqrqvrnelingsaagktvlnlfsytaafsvaaamggamattsvdla
    krsralslahfeanhldmanhqlvvmdvfdyfkyarrhhltydiiiidppsfevfsvskd
    yhklirqgleilsengliiastnaanmtvsqfkkqiekgfgkqkhtyldlqqlpsdfavn
    vqdessnylkvftikv