Lineage for d2b4tq2 (2b4t Q:153-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961800Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (4 PDB entries)
    Uniprot Q8IKK7 153-318! Uniprot Q8T6B1 153-318
  8. 2961811Domain d2b4tq2: 2b4t Q:153-318 [127861]
    Other proteins in same PDB: d2b4to1, d2b4to3, d2b4tp1, d2b4tp3, d2b4tq1, d2b4tq3, d2b4tr1, d2b4tr3
    automated match to d2b4ro2
    complexed with aes, nad

Details for d2b4tq2

PDB Entry: 2b4t (more details), 2.5 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2b4tq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4tq2 d.81.1.1 (Q:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

SCOPe Domain Coordinates for d2b4tq2:

Click to download the PDB-style file with coordinates for d2b4tq2.
(The format of our PDB-style files is described here.)

Timeline for d2b4tq2: