Lineage for d2b4tq2 (2b4t Q:153-318)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728057Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (3 PDB entries)
  8. 728064Domain d2b4tq2: 2b4t Q:153-318 [127861]
    Other proteins in same PDB: d2b4to1, d2b4tp1, d2b4tq1, d2b4tr1
    automatically matched to 2B4R O:153-318
    complexed with aes, nad; mutant

Details for d2b4tq2

PDB Entry: 2b4t (more details), 2.5 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2b4tq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4tq2 d.81.1.1 (Q:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

SCOP Domain Coordinates for d2b4tq2:

Click to download the PDB-style file with coordinates for d2b4tq2.
(The format of our PDB-style files is described here.)

Timeline for d2b4tq2: