SCOPe 2.02: Domain d2b36a_: 2b36 A:

Lineage for d2b36a_ (2b36 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (39 PDB entries)

8. Domain d2b36a_: 2b36 A: [127773]
   automated match to d1bvra_
   complexed with 5pp, nad

Details for d2b36a_

PDB Entry: 2b36, 2.8 Å

PDB Description: crystal structure of mycobacterium tuberculosis enoyl reductase (inha) inhibited by 5-pentyl-2-phenoxyphenol

PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d2b36a_:

Sequence; same for both SEQRES and ATOM records:

>d2b36a_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Timeline for d2b36a_:

• d2b36a_ first appeared in SCOP 1.73, called d2b36a1
  
• d2b36a_ appears in SCOPe 2.01
  
• d2b36a_ appears in SCOPe 2.03
  
• d2b36a_ appears in the current release, SCOPe 2.08