Class b: All beta proteins [48724] (180 folds) |
Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) |
Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins) |
Protein Heat shock protein 40 Sis1 [49495] (1 species) duplication: contains two domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries) |
Domain d2b26b1: 2b26 B:181-259 [127703] Other proteins in same PDB: d2b26a3, d2b26b3 automatically matched to d1c3ga1 |
PDB Entry: 2b26 (more details), 3.2 Å
SCOPe Domain Sequences for d2b26b1:
Sequence, based on SEQRES records: (download)
>d2b26b1 b.4.1.1 (B:181-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdyn pqtgrrktlqfviqekshp
>d2b26b1 b.4.1.1 (B:181-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tvqvnlpvsledlfvgkkksfktqidiqlkpgwkagtkityknktlqfviqekshp
Timeline for d2b26b1: