![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) ![]() |
![]() | Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins) |
![]() | Protein Heat shock protein 40 Sis1 [49495] (1 species) duplication: contains two domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries) |
![]() | Domain d2b26a2: 2b26 A:260-349 [127702] Other proteins in same PDB: d2b26a3, d2b26b3 automatically matched to d1c3ga2 |
PDB Entry: 2b26 (more details), 3.2 Å
SCOPe Domain Sequences for d2b26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b26a2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nfkrdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstypgqgmptp knpsqrgnlivkykvdypislndaqkraid
Timeline for d2b26a2: