SCOP 1.73: Domain d2b26b1: 2b26 B:180-259

Lineage for d2b26b1 (2b26 B:180-259)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (1 family)

5. Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)

6. Protein Heat shock protein 40 Sis1 [49495] (1 species)
   duplication: contains two domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries)

8. Domain d2b26b1: 2b26 B:180-259 [127703]
   automatically matched to d1c3ga1

Details for d2b26b1

PDB Entry: 2b26, 3.2 Å

PDB Description: the crystal structure of the protein complex of yeast hsp40 sis1 and hsp70 ssa1

PDB Compounds: (B:) SIS1 protein

SCOP Domain Sequences for d2b26b1:

Sequence, based on SEQRES records:

>d2b26b1 b.4.1.1 (B:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
npqtgrrktlqfviqekshp

Sequence, based on observed residues (ATOM records):

>d2b26b1 b.4.1.1 (B:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etvqvnlpvsledlfvgkkksfktqidiqlkpgwkagtkityknktlqfviqekshp

Timeline for d2b26b1:

• d2b26b1 is new in SCOP 1.73
  
• d2b26b1 appears in SCOP 1.75
  
• d2b26b1 appears in the current release, SCOPe 2.08