SCOPe 2.08: Domain d2b26b2: 2b26 B:260-349

Lineage for d2b26b2 (2b26 B:260-349)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)

6. Protein Heat shock protein 40 Sis1 [49495] (1 species)
   duplication: contains two domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries)

8. Domain d2b26b2: 2b26 B:260-349 [127704]
   Other proteins in same PDB: d2b26a3, d2b26b3
   automatically matched to d1c3ga2

Details for d2b26b2

PDB Entry: 2b26, 3.2 Å

PDB Description: the crystal structure of the protein complex of yeast hsp40 sis1 and hsp70 ssa1

PDB Compounds: (B:) SIS1 protein

SCOPe Domain Sequences for d2b26b2:

Sequence; same for both SEQRES and ATOM records:

>d2b26b2 b.4.1.1 (B:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfkrdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstypgqgmptp
knpsqrgnlivkykvdypislndaqkraid

Timeline for d2b26b2:

• d2b26b2 first appeared in SCOP 1.73
  
• d2b26b2 appears in SCOPe 2.07