Lineage for d2b24a1 (2b24 A:1-162)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. Species Rhodococcus sp. [TaxId:92694] [255042] (1 PDB entry)
  8. 2782709Domain d2b24a1: 2b24 A:1-162 [127690]
    Other proteins in same PDB: d2b24a2, d2b24b_, d2b24c2, d2b24d_, d2b24e2, d2b24f_
    automated match to d2b1xa1
    complexed with fe, fes, ind

Details for d2b24a1

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (A:) naphthalene dioxygenase large subunit

SCOPe Domain Sequences for d2b24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24a1 b.33.1.0 (A:1-162) automated matches {Rhodococcus sp. [TaxId: 92694]}
mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph

SCOPe Domain Coordinates for d2b24a1:

Click to download the PDB-style file with coordinates for d2b24a1.
(The format of our PDB-style files is described here.)

Timeline for d2b24a1: