SCOPe 2.08: Domain d2b24a1: 2b24 A:1-162

Lineage for d2b24a1 (2b24 A:1-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:92694] [255042] (1 PDB entry)

8. Domain d2b24a1: 2b24 A:1-162 [127690]
   Other proteins in same PDB: d2b24a2, d2b24b_, d2b24c2, d2b24d_, d2b24e2, d2b24f_
   automated match to d2b1xa1
   complexed with fe, fes, ind

Details for d2b24a1

PDB Entry: 2b24, 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole

PDB Compounds: (A:) naphthalene dioxygenase large subunit

SCOPe Domain Sequences for d2b24a1:

Sequence; same for both SEQRES and ATOM records:

>d2b24a1 b.33.1.0 (A:1-162) automated matches {Rhodococcus sp. [TaxId: 92694]}
mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph

Timeline for d2b24a1:

• d2b24a1 first appeared in SCOP 1.73
  
• d2b24a1 appears in SCOPe 2.07