Lineage for d2b24c2 (2b24 C:163-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192753Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2192857Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 protein domains)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2192889Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. Species Rhodococcus sp. [TaxId:92694] [255043] (1 PDB entry)
  8. 2192928Domain d2b24c2: 2b24 C:163-440 [127694]
    Other proteins in same PDB: d2b24a1, d2b24b_, d2b24c1, d2b24d_, d2b24e1, d2b24f_
    automated match to d2b1xa2
    complexed with fe, fes, ind

Details for d2b24c2

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (C:) naphthalene dioxygenase large subunit

SCOPe Domain Sequences for d2b24c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24c2 d.129.3.3 (C:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. [TaxId: 92694]}
adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr
smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp
eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv
ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl
epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp

SCOPe Domain Coordinates for d2b24c2:

Click to download the PDB-style file with coordinates for d2b24c2.
(The format of our PDB-style files is described here.)

Timeline for d2b24c2: