Lineage for d2b24f_ (2b24 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936752Species Rhodococcus sp. [TaxId:92694] [255044] (1 PDB entry)
  8. 2936755Domain d2b24f_: 2b24 F: [127698]
    Other proteins in same PDB: d2b24a1, d2b24a2, d2b24c1, d2b24c2, d2b24e1, d2b24e2
    automated match to d2b1xb1
    complexed with fe, fes, ind

Details for d2b24f_

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (F:) naphthalene dioxygenase small subunit

SCOPe Domain Sequences for d2b24f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24f_ d.17.4.4 (F:) automated matches {Rhodococcus sp. [TaxId: 92694]}
sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim

SCOPe Domain Coordinates for d2b24f_:

Click to download the PDB-style file with coordinates for d2b24f_.
(The format of our PDB-style files is described here.)

Timeline for d2b24f_: