PDB entry 2b24

View 2b24 on RCSB PDB site
Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
Class: oxidoreductase
Keywords: rieske non-heme iron oxygenase, oxidoreductase
Deposited on 2005-09-16, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.287
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24a1, d2b24a2
  • Chain 'B':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24b_
  • Chain 'C':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24c1, d2b24c2
  • Chain 'D':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24d_
  • Chain 'E':
    Compound: naphthalene dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24e1, d2b24e2
  • Chain 'F':
    Compound: naphthalene dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:92694]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b24f_
  • Heterogens: FE, FES, IND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b24A (A:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24A (A:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b24B (B:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24B (B:)
    sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
    dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
    vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b24C (C:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24C (C:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b24D (D:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24D (D:)
    sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
    dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
    vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b24E (E:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesplrdgnsngsgtadastpaaakskspakaea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24E (E:)
    mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd
    yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs
    lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldphadsledylgdlkfyldiv
    ldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthrsmvelglappdpqfalyg
    ehihtghghglgiigpppgmplpefmglpeniveelerrltpeqveifrptafihgtvfp
    nlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflvekdapdwfkdesyksylr
    tfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvlepdpnwtgpgeaypldya
    eanqrnfleywmqlmlaesp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b24F (F:)
    mntqtrvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdv
    vegmthmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnll
    lyrtrgdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b24F (F:)
    sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
    dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
    vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim