Lineage for d2az3d_ (2az3 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2557976Species Halobacterium salinarum [TaxId:2242] [143288] (2 PDB entries)
    Uniprot P61136 4-158
  8. 2557980Domain d2az3d_: 2az3 D: [127591]
    automated match to d1ndla_
    complexed with cdp, mg

Details for d2az3d_

PDB Entry: 2az3 (more details), 2.2 Å

PDB Description: structure of a halophilic nucleoside diphosphate kinase from halobacterium salinarum in complex with cdp
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2az3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2az3d_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Halobacterium salinarum [TaxId: 2242]}
hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
edeganereialffdddelvdwdrdasawvye

SCOPe Domain Coordinates for d2az3d_:

Click to download the PDB-style file with coordinates for d2az3d_.
(The format of our PDB-style files is described here.)

Timeline for d2az3d_: