Lineage for d1ndla_ (1ndl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2557964Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54926] (2 PDB entries)
  8. 2557968Domain d1ndla_: 1ndl A: [39138]

Details for d1ndla_

PDB Entry: 1ndl (more details), 2.4 Å

PDB Description: the awd nucleotide diphosphate kinase from drosophila
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1ndla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndla_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
davesaekeialwfnekelvtwtpaakdwiye

SCOPe Domain Coordinates for d1ndla_:

Click to download the PDB-style file with coordinates for d1ndla_.
(The format of our PDB-style files is described here.)

Timeline for d1ndla_: