SCOPe 2.01: Domain d2ayga1: 2ayg A:281-366

Lineage for d2ayga1 (2ayg A:281-366)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)

8. Domain d2ayga1: 2ayg A:281-366 [127552]
   automatically matched to d1r8ha_
   protein/DNA complex

Details for d2ayga1

PDB Entry: 2ayg, 3.1 Å

PDB Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2ayga1:

Sequence; same for both SEQRES and ATOM records:

>d2ayga1 d.58.8.1 (A:281-366) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

Timeline for d2ayga1:

• d2ayga1 first appeared in SCOP 1.73
  
• d2ayga1 appears in SCOP 1.75
  
• d2ayga1 appears in SCOPe 2.02
  
• d2ayga1 appears in the current release, SCOPe 2.08, called d2ayga_