Lineage for d2ayga1 (2ayg A:281-366)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862477Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 862478Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 862485Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 862511Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)
  8. 862524Domain d2ayga1: 2ayg A:281-366 [127552]
    automatically matched to d1r8ha_

Details for d2ayga1

PDB Entry: 2ayg (more details), 3.1 Å

PDB Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target
PDB Compounds: (A:) Regulatory protein E2

SCOP Domain Sequences for d2ayga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayga1 d.58.8.1 (A:281-366) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

SCOP Domain Coordinates for d2ayga1:

Click to download the PDB-style file with coordinates for d2ayga1.
(The format of our PDB-style files is described here.)

Timeline for d2ayga1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aygb1