Lineage for d2ayga_ (2ayg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952704Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2952705Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2952726Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2952757Species Human papillomavirus type 6a [TaxId:37122] [102990] (4 PDB entries)
  8. 2952770Domain d2ayga_: 2ayg A: [127552]
    automated match to d1r8ha_
    protein/DNA complex

Details for d2ayga_

PDB Entry: 2ayg (more details), 3.1 Å

PDB Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2ayga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayga_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll

SCOPe Domain Coordinates for d2ayga_:

Click to download the PDB-style file with coordinates for d2ayga_.
(The format of our PDB-style files is described here.)

Timeline for d2ayga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aygb_