Lineage for d2axub2 (2axu B:71-303)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010849Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2010850Protein PrgX [140849] (1 species)
  7. 2010851Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 2010865Domain d2axub2: 2axu B:71-303 [127503]
    Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
    automated match to d2aw6a2

Details for d2axub2

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2axub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axub2 a.118.8.4 (B:71-303) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv

SCOPe Domain Coordinates for d2axub2:

Click to download the PDB-style file with coordinates for d2axub2.
(The format of our PDB-style files is described here.)

Timeline for d2axub2: