![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
![]() | Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
![]() | Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
![]() | Domain d2axuh1: 2axu H:3-68 [127514] Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2 automated match to d2aw6a1 |
PDB Entry: 2axu (more details), 2.9 Å
SCOPe Domain Sequences for d2axuh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axuh1 a.35.1.11 (H:3-68) PrgX {Enterococcus faecalis [TaxId: 1351]} kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil nragmn
Timeline for d2axuh1: