![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
![]() | Protein PrgX [140849] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries) Uniprot Q04114 70-287! Uniprot Q04114 71-301 |
![]() | Domain d2axuj2: 2axu J:71-301 [127519] Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1 automated match to d2aw6a2 |
PDB Entry: 2axu (more details), 2.9 Å
SCOPe Domain Sequences for d2axuj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axuj2 a.118.8.4 (J:71-301) PrgX {Enterococcus faecalis [TaxId: 1351]} svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
Timeline for d2axuj2: