Lineage for d2avpa1 (2avp A:1-68)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048350Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 3048351Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 3048352Family k.38.1.1: TPR domain-based design [90309] (3 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 3048353Protein An 8 repeat consensus TPR superhelix [144342] (1 species)
  7. 3048354Species Synthetic [144343] (2 PDB entries)
  8. 3048355Domain d2avpa1: 2avp A:1-68 [127382]
    complexed with cd

Details for d2avpa1

PDB Entry: 2avp (more details), 2.04 Å

PDB Description: Crystal structure of an 8 repeat consensus TPR superhelix
PDB Compounds: (A:) synthetic consensus tpr protein

SCOPe Domain Sequences for d2avpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avpa1 k.38.1.1 (A:1-68) An 8 repeat consensus TPR superhelix {Synthetic}
aeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyyqk
aleldprs

SCOPe Domain Coordinates for d2avpa1:

Click to download the PDB-style file with coordinates for d2avpa1.
(The format of our PDB-style files is described here.)

Timeline for d2avpa1: