PDB entry 2avp

View 2avp on RCSB PDB site
Description: Crystal structure of an 8 repeat consensus TPR superhelix
Class: de novo protein
Keywords: tetratricopeptide repeat, TPR, consensus protein, superhelix, DE NOVO PROTEIN
Deposited on 2005-08-30, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: synthetic consensus tpr protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2AVP (Start-69)
  Domains in SCOPe 2.08: d2avpa1
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2avpA (A:)
  gsaeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyy
  qkaleldprs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2avpA (A:)
  aeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyyqk
  aleldprs