Lineage for d2avpa1 (2avp A:1-68)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 758226Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 758227Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 758228Family k.38.1.1: TPR domain-based design [90309] (3 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 758229Protein An 8 repeat consensus TPR superhelix [144342] (1 species)
  7. 758230Species synthetic [144343] (2 PDB entries)
  8. 758231Domain d2avpa1: 2avp A:1-68 [127382]

Details for d2avpa1

PDB Entry: 2avp (more details), 2.04 Å

PDB Description: Crystal structure of an 8 repeat consensus TPR superhelix
PDB Compounds: (A:) synthetic consensus tpr protein

SCOP Domain Sequences for d2avpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avpa1 k.38.1.1 (A:1-68) An 8 repeat consensus TPR superhelix {synthetic}
aeawynlgnayykqgdydeaieyyqkaleldprsaeawynlgnayykqgdydeaieyyqk
aleldprs

SCOP Domain Coordinates for d2avpa1:

Click to download the PDB-style file with coordinates for d2avpa1.
(The format of our PDB-style files is described here.)

Timeline for d2avpa1: