Lineage for d2au5a1 (2au5 A:1-132)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754417Fold a.244: EF2947-like [140606] (1 superfamily)
    4 helices; "diamond" array; duplication: N-terminal and C-terminal pairs of helices are related by pseudo dyad
  4. 1754418Superfamily a.244.1: EF2947-like [140607] (1 family) (S)
  5. 1754419Family a.244.1.1: EF2947-like [140608] (1 protein)
  6. 1754420Protein Hypothetical protein EF2947 [140609] (1 species)
  7. 1754421Species Enterococcus faecalis [TaxId:1351] [140610] (1 PDB entry)
    Uniprot Q82ZV0 1-132
  8. 1754422Domain d2au5a1: 2au5 A:1-132 [127322]
    complexed with po4

Details for d2au5a1

PDB Entry: 2au5 (more details), 2.1 Å

PDB Description: Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d2au5a1:

Sequence, based on SEQRES records: (download)

>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]}
mlilstekepnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaag
gmqgvivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftfll
lcsdefimylds

Sequence, based on observed residues (ATOM records): (download)

>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]}
mlilspnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaaggmqg
vivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftflllcsd
efimylds

SCOPe Domain Coordinates for d2au5a1:

Click to download the PDB-style file with coordinates for d2au5a1.
(The format of our PDB-style files is described here.)

Timeline for d2au5a1: