SCOP 1.73: Domain d2au5a1: 2au5 A:1-132

Lineage for d2au5a1 (2au5 A:1-132)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.244: EF2947-like [140606] (1 superfamily)
   4 helices; "diamond" array; duplication: N-terminal and C-terminal pairs of helices are related by pseudo dyad

4. Superfamily a.244.1: EF2947-like [140607] (1 family)

5. Family a.244.1.1: EF2947-like [140608] (1 protein)

6. Protein Hypothetical protein EF2947 [140609] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140610] (1 PDB entry)

8. Domain d2au5a1: 2au5 A:1-132 [127322]
   complexed with po4

Details for d2au5a1

PDB Entry: 2au5, 2.1 Å

PDB Description: Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583

PDB Compounds: (A:) conserved domain protein

SCOP Domain Sequences for d2au5a1:

Sequence, based on SEQRES records:

>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]}
mlilstekepnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaag
gmqgvivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftfll
lcsdefimylds

Sequence, based on observed residues (ATOM records):

>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]}
mlilspnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaaggmqg
vivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftflllcsd
efimylds

Timeline for d2au5a1:

• d2au5a1 is new in SCOP 1.73
  
• d2au5a1 appears in SCOP 1.75
  
• d2au5a1 appears in the current release, SCOPe 2.08