![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.244: EF2947-like [140606] (1 superfamily) 4 helices; "diamond" array; duplication: N-terminal and C-terminal pairs of helices are related by pseudo dyad |
![]() | Superfamily a.244.1: EF2947-like [140607] (1 family) ![]() |
![]() | Family a.244.1.1: EF2947-like [140608] (1 protein) |
![]() | Protein Hypothetical protein EF2947 [140609] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [140610] (1 PDB entry) Uniprot Q82ZV0 1-132 |
![]() | Domain d2au5a1: 2au5 A:1-132 [127322] Other proteins in same PDB: d2au5a2 complexed with po4 |
PDB Entry: 2au5 (more details), 2.1 Å
SCOPe Domain Sequences for d2au5a1:
Sequence, based on SEQRES records: (download)
>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]} mlilstekepnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaag gmqgvivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftfll lcsdefimylds
>d2au5a1 a.244.1.1 (A:1-132) Hypothetical protein EF2947 {Enterococcus faecalis [TaxId: 1351]} mlilspnfeyeeitrsflsnmlaftrghftgdishfspivlaemekdpnwleeaaggmqg vivqslledenfssveqlkgelarlirlyfalakdnltenqeslyvdlfdkftflllcsd efimylds
Timeline for d2au5a1: