![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
![]() | Protein CksHs1 [55645] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries) |
![]() | Domain d2astc_: 2ast C: [127275] Other proteins in same PDB: d2astb1, d2astb2 automated match to d1dksb_ complexed with ben |
PDB Entry: 2ast (more details), 2.3 Å
SCOPe Domain Sequences for d2astc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2astc_ d.97.1.1 (C:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]} qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep hillfrrpl
Timeline for d2astc_: