Lineage for d2astc_ (2ast C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663212Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 1663213Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 1663214Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 1663220Protein CksHs1 [55645] (1 species)
  7. 1663221Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 1663222Domain d2astc_: 2ast C: [127275]
    Other proteins in same PDB: d2astb1, d2astb2
    automated match to d1dksb_
    complexed with ben

Details for d2astc_

PDB Entry: 2ast (more details), 2.3 Å

PDB Description: crystal structure of skp1-skp2-cks1 in complex with a p27 peptide
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 1

SCOPe Domain Sequences for d2astc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2astc_ d.97.1.1 (C:) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrpl

SCOPe Domain Coordinates for d2astc_:

Click to download the PDB-style file with coordinates for d2astc_.
(The format of our PDB-style files is described here.)

Timeline for d2astc_: