Lineage for d2astc1 (2ast C:3005-3073)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730534Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 730535Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 730536Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 730542Protein CksHs1 [55645] (1 species)
  7. 730543Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries)
  8. 730544Domain d2astc1: 2ast C:3005-3073 [127275]
    Other proteins in same PDB: d2astb1, d2astb2
    automatically matched to d1dksa_
    complexed with ben

Details for d2astc1

PDB Entry: 2ast (more details), 2.3 Å

PDB Description: Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
PDB Compounds: (C:) Cyclin-dependent kinases regulatory subunit 1

SCOP Domain Sequences for d2astc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2astc1 d.97.1.1 (C:3005-3073) CksHs1 {Human (Homo sapiens) [TaxId: 9606]}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrpl

SCOP Domain Coordinates for d2astc1:

Click to download the PDB-style file with coordinates for d2astc1.
(The format of our PDB-style files is described here.)

Timeline for d2astc1: