Lineage for d2astb1 (2ast B:2097-2135)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752306Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 1752307Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 1752308Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 1752323Protein Skp2 [81379] (1 species)
  7. 1752324Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)
  8. 1752327Domain d2astb1: 2ast B:2097-2135 [127273]
    Other proteins in same PDB: d2astb2, d2astc_
    automatically matched to d1fs1a1
    complexed with ben

Details for d2astb1

PDB Entry: 2ast (more details), 2.3 Å

PDB Description: crystal structure of skp1-skp2-cks1 in complex with a p27 peptide
PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2astb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2astb1 a.158.1.1 (B:2097-2135) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
wdslpdelllgifsclclpellkvsgvckrwyrlasdes

SCOPe Domain Coordinates for d2astb1:

Click to download the PDB-style file with coordinates for d2astb1.
(The format of our PDB-style files is described here.)

Timeline for d2astb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2astb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2astc_