SCOPe 2.08: Domain d2astb1: 2ast B:2097-2135

Lineage for d2astb1 (2ast B:2097-2135)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.158: F-box domain [81385] (1 superfamily)
   multihelical; interlocked heterodimer with the Skp1 dimerisation domain

4. Superfamily a.158.1: F-box domain [81383] (1 family)

5. Family a.158.1.1: F-box domain [81381] (4 proteins)

6. Protein Skp2 [81379] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)

8. Domain d2astb1: 2ast B:2097-2135 [127273]
   Other proteins in same PDB: d2astb2, d2astc_
   automatically matched to d1fs1a1
   complexed with ben
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2astb1

PDB Entry: 2ast, 2.3 Å

PDB Description: crystal structure of skp1-skp2-cks1 in complex with a p27 peptide

PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2astb1:

Sequence; same for both SEQRES and ATOM records:

>d2astb1 a.158.1.1 (B:2097-2135) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
wdslpdelllgifsclclpellkvsgvckrwyrlasdes

Timeline for d2astb1:

• d2astb1 first appeared in SCOP 1.73
  
• d2astb1 appears in SCOPe 2.07