![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
![]() | Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
![]() | Family a.158.1.1: F-box domain [81381] (4 proteins) |
![]() | Protein Skp2 [81379] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries) |
![]() | Domain d2assb1: 2ass B:2095-2133 [127270] Other proteins in same PDB: d2assa1, d2assa2, d2assb2, d2assc_ automated match to d1fqva1 complexed with ben, po4 |
PDB Entry: 2ass (more details), 3 Å
SCOPe Domain Sequences for d2assb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2assb1 a.158.1.1 (B:2095-2133) Skp2 {Human (Homo sapiens) [TaxId: 9606]} vswdslpdelllgifsclclpellkvsgvckrwyrlasd
Timeline for d2assb1: