SCOPe 2.04: Domain d2assb2: 2ass B:2134-2419

Lineage for d2assb2 (2ass B:2134-2419)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (4 families)
   regular structure consisting of similar repeats

5. Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
   this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain

6. Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries)

8. Domain d2assb2: 2ass B:2134-2419 [127271]
   Other proteins in same PDB: d2assa1, d2assa2, d2assb1, d2assc_
   automated match to d1fqva2
   complexed with ben, po4

Details for d2assb2

PDB Entry: 2ass, 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex

PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2assb2:

Sequence; same for both SEQRES and ATOM records:

>d2assb2 c.10.1.3 (B:2134-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
eslwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvi
evstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtlls
scsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlv
hldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpd
gtlqllkealphlqincshfttiarptignkknqeiwgikcrltlq

Timeline for d2assb2:

• d2assb2 first appeared in SCOP 1.73
  
• d2assb2 appears in SCOPe 2.03
  
• d2assb2 appears in SCOPe 2.05
  
• d2assb2 appears in the current release, SCOPe 2.08