SCOPe 2.08: Domain d2assb1: 2ass B:2095-2133

Lineage for d2assb1 (2ass B:2095-2133)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.158: F-box domain [81385] (1 superfamily)
   multihelical; interlocked heterodimer with the Skp1 dimerisation domain

4. Superfamily a.158.1: F-box domain [81383] (1 family)

5. Family a.158.1.1: F-box domain [81381] (4 proteins)

6. Protein Skp2 [81379] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)

8. Domain d2assb1: 2ass B:2095-2133 [127270]
   Other proteins in same PDB: d2assa1, d2assa2, d2assb2, d2assc_
   automated match to d1fqva1
   complexed with ben, po4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2assb1

PDB Entry: 2ass, 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex

PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2assb1:

Sequence; same for both SEQRES and ATOM records:

>d2assb1 a.158.1.1 (B:2095-2133) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd

Timeline for d2assb1:

• d2assb1 first appeared in SCOP 1.73
  
• d2assb1 appears in SCOPe 2.07