Lineage for d2assa1 (2ass A:1002-1059)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945520Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 2945521Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries)
  8. 2945525Domain d2assa1: 2ass A:1002-1059 [238618]
    Other proteins in same PDB: d2assa2, d2assb1, d2assb2, d2assc_
    automated match to d1fs1b2
    complexed with ben, po4

    missing some secondary structures that made up less than one-third of the common domain

Details for d2assa1

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2assa1:

Sequence, based on SEQRES records: (download)

>d2assa1 d.42.1.1 (A:1002-1059) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthh

Sequence, based on observed residues (ATOM records): (download)

>d2assa1 d.42.1.1 (A:1002-1059) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh

SCOPe Domain Coordinates for d2assa1:

Click to download the PDB-style file with coordinates for d2assa1.
(The format of our PDB-style files is described here.)

Timeline for d2assa1: