SCOP 1.73: Domain d2arhb1: 2arh B:1-196

Lineage for d2arhb1 (2arh B:1-196)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.9: Aq 1966-like [143720] (1 protein)
   Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold

6. Protein Hypothetical protein Aq_1966 [143721] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry)

8. Domain d2arhb1: 2arh B:1-196 [127198]
   automatically matched to 2ARH A:1-196
   complexed with ca, se, so4

Details for d2arhb1

PDB Entry: 2arh, 2.46 Å

PDB Description: crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5

PDB Compounds: (B:) hypothetical protein aq_1966

SCOP Domain Sequences for d2arhb1:

Sequence; same for both SEQRES and ATOM records:

>d2arhb1 d.108.1.9 (B:1-196) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw
qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals
rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce
deglikkvkerynfle

Timeline for d2arhb1:

• d2arhb1 is new in SCOP 1.73
  
• d2arhb1 appears in SCOP 1.75
  
• d2arhb1 appears in the current release, SCOPe 2.08, called d2arhb_