SCOPe 2.08: Domain d2arhb_: 2arh B:

Lineage for d2arhb_ (2arh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.9: Aq_1966-like [143720] (1 protein)
   Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold

6. Protein Hypothetical protein Aq_1966 [143721] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry)
   Uniprot O67778 1-196

8. Domain d2arhb_: 2arh B: [127198]
   Other proteins in same PDB: d2arha2
   automated match to d2arha1
   complexed with ca, se, so4

Details for d2arhb_

PDB Entry: 2arh, 2.46 Å

PDB Description: crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5

PDB Compounds: (B:) hypothetical protein aq_1966

SCOPe Domain Sequences for d2arhb_:

Sequence; same for both SEQRES and ATOM records:

>d2arhb_ d.108.1.9 (B:) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw
qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals
rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce
deglikkvkerynfleh

Timeline for d2arhb_:

• d2arhb_ first appeared in SCOP 1.73, called d2arhb1
  
• d2arhb_ appears in SCOPe 2.07