PDB entry 2arh

View 2arh on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function AQ1966 from Aquifex aeolicus VF5
Class: structural genomics, unknown function
Keywords: hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-08-19, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein aq_1966
    Species: Aquifex aeolicus
    Gene: aq_1966
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67778 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • engineered (139)
      • modified residue (145)
    Domains in SCOP 1.73: d2arha1
  • Chain 'B':
    Compound: hypothetical protein aq_1966
    Species: Aquifex aeolicus
    Gene: aq_1966
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67778 (2-End)
      • modified residue (2)
      • engineered (139)
      • modified residue (145)
    Domains in SCOP 1.73: d2arhb1
  • Chain 'C':
    Compound: hypothetical protein aq_1966
    Species: Aquifex aeolicus
    Gene: aq_1966
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67778
      • engineered (139)
      • modified residue (145)
    Domains in SCOP 1.73: d2arhc1
  • Heterogens: SO4, CA, SE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2arhA (A:)
    damvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkp
    ywqpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppa
    lsrlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigk
    cedeglikkvkerynflehegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arhA (A:)
    damvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkp
    ywqpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppa
    lsrlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigk
    cedeglikkvkerynfle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2arhB (B:)
    damvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkp
    ywqpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppa
    lsrlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigk
    cedeglikkvkerynflehegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arhB (B:)
    mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw
    qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals
    rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce
    deglikkvkerynfleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2arhC (C:)
    damvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkp
    ywqpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppa
    lsrlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigk
    cedeglikkvkerynflehegss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arhC (C:)
    vkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywq
    pwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsr
    lgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigegli
    kkvkerynf