Lineage for d2am9a_ (2am9 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747088Protein Androgen receptor [63621] (4 species)
  7. 1747098Species Human (Homo sapiens) [TaxId:9606] [63623] (50 PDB entries)
    Uniprot P10275 671-919
  8. 1747101Domain d2am9a_: 2am9 A: [126999]
    automated match to d1e3ga_
    complexed with dtt, gol, so4, tes

Details for d2am9a_

PDB Entry: 2am9 (more details), 1.64 Å

PDB Description: Crystal structure of human androgen receptor ligand binding domain in complex with testosterone
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2am9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2am9a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfhtq

SCOPe Domain Coordinates for d2am9a_:

Click to download the PDB-style file with coordinates for d2am9a_.
(The format of our PDB-style files is described here.)

Timeline for d2am9a_: