Lineage for d2am9a1 (2am9 A:670-918)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647847Protein Androgen receptor [63621] (3 species)
  7. 647857Species Human (Homo sapiens) [TaxId:9606] [63623] (15 PDB entries)
  8. 647858Domain d2am9a1: 2am9 A:670-918 [126999]
    automatically matched to d1e3ga_
    complexed with dtt, gol, so4, tes

Details for d2am9a1

PDB Entry: 2am9 (more details), 1.64 Å

PDB Description: Crystal structure of human androgen receptor ligand binding domain in complex with testosterone
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d2am9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2am9a1 a.123.1.1 (A:670-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

SCOP Domain Coordinates for d2am9a1:

Click to download the PDB-style file with coordinates for d2am9a1.
(The format of our PDB-style files is described here.)

Timeline for d2am9a1: