Lineage for d2am9a_ (2am9 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Androgen receptor [63621] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. Domain d2am9a_: 2am9 A: [126999]
    automated match to d1e3ga_
    complexed with dtt, gol, so4, tes

Details for d2am9a_

PDB Entry: 2am9 (more details), 1.64 Å

PDB Description: Crystal structure of human androgen receptor ligand binding domain in complex with testosterone
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2am9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2am9a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfhtq

SCOPe Domain Coordinates for d2am9a_ are not available.

Timeline for d2am9a_: