SCOPe 2.04: Domain d2alma2: 2alm A:252-409

Lineage for d2alma2 (2alm A:252-409)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries)

8. Domain d2alma2: 2alm A:252-409 [126979]
   automated match to d1ox0a2
   complexed with mg; mutant

Details for d2alma2

PDB Entry: 2alm, 2.6 Å

PDB Description: crystal structure analysis of a mutant beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae

PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier-protein) synthase II

SCOPe Domain Sequences for d2alma2:

Sequence; same for both SEQRES and ATOM records:

>d2alma2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnaagtstpane
kgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvyaqglekeipyaisntfgfgghnavlafkrwe

Timeline for d2alma2:

• d2alma2 first appeared in SCOP 1.73
  
• d2alma2 appears in SCOPe 2.03
  
• d2alma2 appears in SCOPe 2.05
  
• d2alma2 appears in the current release, SCOPe 2.08