Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (9 proteins) |
Protein Beta-ketoacyl-ACP synthase II [53909] (6 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries) |
Domain d1ox0a2: 1ox0 A:252-409 [87496] complexed with mg |
PDB Entry: 1ox0 (more details), 1.3 Å
SCOPe Domain Sequences for d1ox0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane kgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy ieanvvygqglekeipyaisntfgfgghnavlafkrwe
Timeline for d1ox0a2: