Lineage for d2akzb2 (2akz B:1001-1139)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein Enolase [54828] (10 species)
  7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. Domain d2akzb2: 2akz B:1001-1139 [126947]
    Other proteins in same PDB: d2akza1, d2akza3, d2akzb1
    automated match to d1te6a2
    complexed with f, mg, po4, trs

Details for d2akzb2

PDB Entry: 2akz (more details), 1.36 Å

PDB Description: fluoride inhibition of enolase: crystal structure of the inhibitory complex
PDB Compounds: (B:) Gamma enolase

SCOPe Domain Sequences for d2akzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akzb2 d.54.1.1 (B:1001-1139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d2akzb2 are not available.

Timeline for d2akzb2:

Domains from same chain:
(mouse over for more information)
d2akzb1
Domains from other chains:
(mouse over for more information)
d2akza1, d2akza2, d2akza3